PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00032.103
Common NameAMTR_s00032p00142260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 128aa    MW: 14128.1 Da    PI: 5.9688
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00032.103genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.74.1e-19217447100
                                    DUF260  47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                               ++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal+++e
  evm_27.model.AmTr_v1.0_scaffold00032.103  21 QELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQTQLALTQAE 74 
                                               799**********************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.4175IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-172172IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MVSVICKWWE WRTDIPGSWH QELPEHQRGD AVSSMVYEAN ARVRDPVYGC VGAISSLQQQ  60
IDALQTQLAL TQAEVVQLRM RASMLSSLVG GPMDGSLPPN KHGVHHAKSM FAVEVDQPNL  120
SETLWTC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011626627.14e-74PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE94e-26LBD4_ARATH; LOB domain-containing protein 4
TrEMBLU5CNW83e-91U5CNW8_AMBTC; Uncharacterized protein
STRINGPGSC0003DMT4000222862e-39(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-27LOB domain-containing protein 4
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]